PACAP 1-27
Synonym(s):PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem;PACAP-27;Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
- CAS NO.：127317-03-7
- Empirical Formula: C142H224N40O39S
- Molecular Weight: 3147.61
- MDL number: MFCD00167418
- SAFETY DATA SHEET (SDS)
- Update Date: 2024-05-07 17:43:10
What is PACAP 1-27?
The Uses of PACAP 1-27
Pituitary Adenylate Cyclase-Activating Polypeptide 1-27 (PACAP 1-27) is a neuropeptide that stimulates adenylyl cyclase.
Biological Functions
PACAP 1-27 is an endogenous neuropeptide and is the C-terminally truncated form of PACAP 38. PACAP 27 has considerable homology with vasoactive intestinal peptide (VIP) but is >100 fold more potent than VIP as an agonist of the PAC1 receptor. PACAP 27 functions in the control of anterior pituitary hormone secretion, vasodilation, adrenaline secretion, insulin secretion and immunosuppression.
Biological Activity
PACAP 1-27, also known as PACAP 27 Amide, is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). Potently stimulates adenylyl cyclase.
storage
Store at -20°C
Properties of PACAP 1-27
| Density | 1.45±0.1 g/cm3(Predicted) |
| storage temp. | −20°C |
| solubility | H2OPeptide Solubility and Storage Guidelines:1.??Calculate the length of the peptide.2.??Calculate the overall charge of the entire peptide according to the following table:3.??Recommended solution: |
| form | solid |
| color | white |
| Water Solubility | Soluble to 1 mg/ml in water |
Safety information for PACAP 1-27
Computed Descriptors for PACAP 1-27
| InChIKey | RZGBUJXSKLDAFE-XVTUQGJWNA-N |
New Products
4-AMINO-TETRAHYDRO-PYRAN-4-CARBOXYLIC ACID HCL 4-(Dimethylamino)tetrahydro-2H-pyran-4-carbonitrile 4-Aminotetrahydropyran-4-carbonitrile Hydrochloride (R)-3-Aminobutanenitrile Hydrochloride 3-((Dimethylamino)methyl)-5-methylhexan-2-one oxalate 1,4-Dioxa-8-azaspiro[4.5]decane 5-Bromo-2-nitropyridine Nimesulide BP Aceclofenac IP/BP/EP Diclofenac Sodium IP/BP/EP/USP Mefenamic Acid IP/BP/EP/USP Ornidazole IP Diclofenac Potassium THOMAIND PAPER PH 2.0 TO 4.5 1 BOX BUFFER CAPSULE PH 9.2 - 10 CAP SODIUM CHLORIDE 0.1N CVS ALLOXAN MONOHYDRATE 98% PLATINUM 0.5% ON 3 MM ALUMINA PELLETS (TYPE 73) LITHIUM AAS SOLUTION 2-Bromo-1-(bromomethyl)-3-chloro-5-nitrobenzene 2-Bromo-3-nitroaniline N-(3-Hydroxypropyl)-N-methylacetamide 3-Bromo-6-chloropyridazine 4-ethyl-3-nitrobenzoic acidRelated products of tetrahydrofuran
You may like
-
PACAP 27 Amide, Ovine CAS 127317-03-7View Details
127317-03-7 -
1-Methyl-6-oxo-1,6-dihydropyridazine-3-carbonitrile 98%View Details
99903-60-3 -
1823368-42-8 98%View Details
1823368-42-8 -
2-(3-(tert-butyl)phenoxy)-2-methylpropanoic acid 1307449-08-6 98%View Details
1307449-08-6 -
Ethyl 3-(furan-2-yl)-3-hydroxypropanoate 25408-95-1 98%View Details
25408-95-1 -
2-Chloro-5-fluoro-1-methoxy-3-methylbenzene 98%View Details
1805639-70-6 -
1784294-80-9 98%View Details
1784294-80-9 -
Lithium ClavulanateView Details
61177-44-4
Statement: All products displayed on this website are only used for non medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.