Contact us: +91 9550333722 040 - 40102781
Structured search
India
Choose your country
Different countries will display different contents
Try our best to find the right business for you.
My chemicalbook

Welcome back!

Homecas127317-03-7

127317-03-7

127317-03-7 structural image
Product Name: PACAP 1-27
Formula: C142H224N40O39S
Synonyms: PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem;PACAP-27;Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
Inquiry

COMPUTED DESCRIPTORS

Molecular Weight 3147.6 g/mol
XLogP3 -10.3
Hydrogen Bond Donor Count 48
Hydrogen Bond Acceptor Count 47
Rotatable Bond Count 107
Exact Mass 3146.6528635 g/mol
Monoisotopic Mass 3145.6495086 g/mol
Topological Polar Surface Area 1340 Ų
Heavy Atom Count 222
Formal Charge 0
Complexity 7000
Isotope Atom Count 0
Defined Atom Stereocenter Count 0
Undefined Atom Stereocenter Count 28
Defined Bond Stereocenter Count 0
Undefined Bond Stereocenter Count 0
Covalently-Bonded Unit Count 1
Compound Is Canonicalized Yes