Contact us: +91 9550333722 040 - 40102781
Structured search
India
Choose your country
Different countries will display different contents
Try our best to find the right business for you.
My chemicalbook

Welcome back!

HomecompanyGLP-2 (RAT)
GLP-2 (RAT)
GLP-2 (RAT)

GLP-2 (RAT)

Price USD7.00
Packge 1KG
  • Min. Order:1KG
  • Supply Ability:100KG
  • Time:2020-02-14

Product Details

  • Product NameGLP-2 (RAT)
  • CAS No. 195262-56-7
  • MFC166H256N44O56S
  • MW3796.13504
  • AppearancePowderWhite to off-white
  • storage temp.  -15°C
  • Water Solubility Soluble to 1 mg/ml in water
Product Name: GLP-2 (RAT)
Synonyms: REF DUPL: H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH;GLP-2 (rat) Glucagon-Like Peptide 2 (rat), Proglucagon (126-158) (rat), Preproglucagon (146-178) (rat);GLUCAGON-LIKE PEPTIDE 2 (RAT);GLUCAGON-LIKE PEPTIDE II RAT;GLP-2 (RAT);Glucagon-Like Peptide 2 (rat), Proglucagon (126-158) (rat), Preproglucagon (146-178) (rat);H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-THR-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLATRDFINWLIQTKITD
CAS: 195262-56-7
MF: C166H256N44O56S
MW: 3796.13504
EINECS:
Product Categories: Peptide;Glucagon receptor and related
Mol File: 195262-56-7.mol
GLP-2 (RAT) Structure
GLP-2 (RAT) Chemical Properties
storage temp. -15°C
Safety Information
MSDS Information
GLP-2 (RAT) Usage And Synthesis
GLP-2 (RAT) Preparation Products And Raw materials

Company Profile Introduction

Established in 2014,Career Henan Chemical Co. is a manufacturerspecializing in the sale of fine chemicals. Mainly deals in the sales of: Pharmaceutical intermediates OLED intermediates: Pharmaceutical intermediates; OLED intermediates;
  • Since:2014-12-17
  • Address: Room 702, Floor 7, Building 10, National University Science Park, High-Tech Zone, Zhengzhou City, H
INQUIRY