Hot Sale Raw Powder Dulaglutide
Price | USD9.90 | USD8.80 |
Packge | 10g | 1000g |
- Min. Order:10g
- Supply Ability:1000kgs
- Time:2022-03-08
Product Details
- Product NameDulaglutide
- CAS No.923950-08-7
- EINECS No.200-001-8
- MW0
- AppearanceLiquidColorless to light yellow
Hot Sale Raw Powder Dulaglutide
Basic Information
Common Name | Dulaglutide | ||
---|---|---|---|
CAS Number | 923950-08-7 | Molecular Weight | 3314.62 |
Density | 1.4±0.1 g/cm3 | Boiling Point | N/A |
Molecular Formula | C149H221N37O49 | Melting Point | N/A |
MSDS | N/A | Flash Point | N/A |
Use of Dulaglutide
Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG.
Contact us
Our Company
Shanghai Biolang Biological Co., Ltd has a registered capital of 1 million yuan and is one of the most dynamic foreign trade companies in the Chinese market. We have a pharmaceutical raw material production plant and a reagent R&D center. We now have the most complete product line. In addition, we have developed and produced tens of thousands of reagents. We also have the business of custom synthesis of various organic compounds as a supplement. We can synthesize almost all chemicals. Our goal is to survive by quality and develop by credit.
In the past two years, our products have spread over more than 30 countries in the world, Europe, South America, North America, Southeast Asia and Africa. We work with friends all over the world to develop the best quality products, the most reasonable prices and safe and effective transportation. Product can be ordered from milligrams to tons. Meet the purchase of new and old customers. We will not let you down.
Payment & Delivery
Why choose us?
1. Products with high purity and good quality
2. Choose the most suitable price according to customer needs to achieve a win-win situation.
3. Spot samples can be shipped quickly after payment, saving time for receiving goods.
4. Track the transportation of goods throughout the process
5. Safe raw materials from China
6. Have professional customs clearance capabilities and the best pre-sales and after-sales services.
our service
1. Cooperate with scientific research institutes and major factories to strictly control the entire process of products from raw materials to finished products
2. Customer first, we provide reasonable prices, high-quality products and timely delivery.
3. We can send the goods directly to your receiving address.
4. Quickly and accurately answer customers' doubts
5. If you place a large number of orders with us, we can provide preferential prices
6. Products can be packaged according to customer requirements.
FAQ
Q1: Can I get some samples?
Answer: Yes, we can provide free samples, but the freight is paid by our customers.
Q2: How to confirm the product quality before placing an order?
Answer: You can get samples of some products for free, you only need to pay the freight or arrange express delivery to us and get the samples. You can send us your product specifications and requirements, and we will manufacture products according to your requirements.
Q3: How to start an order or payment?
After the order is confirmed, the PI will be sent first with our bank information. Payment via T/T, Western Union, Letter of Credit, Alibaba Trade Assurance, Cashapp, Moneygram or Bitcoin.
Q4: How to place an order?
You can contact me through Trademanager, WhatsApp, Skype Online and other contact methods, tell me the product and quantity you need, and we will give you a quote. If you choose one of the above payment methods, we will arrange delivery for you.
Q5: Are there any discounts?
Answer: There are different discounts for different quantities.
Q6: How about your delivery time?
Answer: Generally speaking, it will take 3 to 5 days after receiving your prepayment. (Excluding Chinese holidays)
Q6: How do you deal with quality complaints?
Answer: First of all, our quality control will reduce quality problems to close to zero. If the quality problem is indeed caused by us, we will replace it for you free of charge or refund your loss.
Company Profile Introduction
- Since:2015-12-25
- Address: Room D621, Building 7, No. 228, Jingle Road, Langxia Town, Jinshan District, Shanghai