LL-37
| Price | USD7.00 |
| Packge | 1KG |
- Min. Order:1KG
- Supply Ability:100KG
- Time:2020-02-14
Product Details
- Product Name LL-37
- CAS No.154947-66-7
- EINECS No.211-519-9
- MFC205H340N60O53
- MW0
- AppearanceA lyophilized powderWhite to off-white
- Water Solubility Soluble to 1 mg/ml in water
Product Name: LL-37
Synonyms: Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt)
CAS: 154947-66-7
MF: C205H340N60O53
MW: 0
EINECS: -0
Product Categories:
Mol File: Mol File
LL-37 Structure
Company Profile Introduction
Established in 2014,Career Henan Chemical Co. is a manufacturerspecializing in the sale of fine chemicals.
Mainly deals in the sales of:
Pharmaceutical intermediates
OLED intermediates：
Pharmaceutical intermediates;
OLED intermediates;
Recommended supplier
- Since:2014-12-17
- Address: Room 702, Floor 7, Building 10, National University Science Park, High-Tech Zone, Zhengzhou City, H
INQUIRY