Contact us: +91 9550333722 040 - 40102781
Structured search
India
Choose your country
Different countries will display different contents
Try our best to find the right business for you.
My chemicalbook

Welcome back!

HomecompanyAMYLIN (8-37) (RAT)
AMYLIN (8-37) (RAT)
AMYLIN (8-37) (RAT)

AMYLIN (8-37) (RAT)

Price USD7.00
Packge 1KG
  • Min. Order:1KG
  • Supply Ability:100kg
  • Time:2020-02-14

Product Details

  • Product NameAMYLIN (8-37) (RAT)
  • CAS No. 138398-61-5
  • MFC140H227N43O43
  • MW3200.61
  • AppearanceSolidWhite to off-white
  • storage temp.  -15°C
  • density 1.51±0.1 g/cm3(Predicted)
Product Name: AMYLIN (8-37) (RAT)
Synonyms: Amylin (8-37) (mouse, rat) H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2;AMYLIN (8-37) (RAT);ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2;H-ALA-THR-GLN-ARG-LEU-ALA-ASN-PHE-LEU-VAL-ARG-SER-SER-ASN-ASN-LEU-GLY-PRO-VAL-LEU-PRO-PRO-THR-ASN-VAL-GLY-SER-ASN-THR-TYR-NH2;diabetes associated peptide amide*fragment 8-37 R;Amylin (8-37) (mouse, rat);Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
CAS: 138398-61-5
MF: C140H227N43O43
MW: 3200.56
EINECS:
Product Categories: Peptide
Mol File: 138398-61-5.mol
AMYLIN (8-37) (RAT) Structure
AMYLIN (8-37) (RAT) Chemical Properties
storage temp. -15°C

Company Profile Introduction

Established in 2014,Career Henan Chemical Co. is a manufacturerspecializing in the sale of fine chemicals. Mainly deals in the sales of: Pharmaceutical intermediates OLED intermediates: Pharmaceutical intermediates; OLED intermediates;
  • Since:2014-12-17
  • Address: Room 702, Floor 7, Building 10, National University Science Park, High-Tech Zone, Zhengzhou City, H
INQUIRY