Contact us: +91 9550333722 040 - 40102781
Structured search
India
Choose your country
Different countries will display different contents
Try our best to find the right business for you.
My chemicalbook

Welcome back!

HomecompanyCalcitonin salmon
Calcitonin salmon
Calcitonin salmon

Calcitonin salmon

Price USD20.00
Packge 1KG
  • Min. Order:1KG
  • Supply Ability:50kg
  • Time:2019-07-06

Product Details

  • Product NameCalcitonin salmon
  • CAS No. 47931-85-1
  • EINECS No.256-342-8
  • MFC145H240N44O48S2
  • MW3431.85
  • AppearancepowderWhite to Off-White
  • storage temp. −20°C
  • Water Solubility Soluble in water at 1mg/ml
  • density 1.54±0.1 g/cm3(Predicted)
  • Melting point >222oC (dec.)

jessie606

Calcitonin salmon Basic information
Description Sequence Biological Activity Active Substance Application Indication Pharmacodynamics Mechanism of action References
Product Name: Calcitonin salmon
Synonyms: CALCITONIN, SALMON;CALCITONIN (SALMON I);CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7);CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 SALMON;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7)
CAS: 47931-85-1
MF: C145H240N44O48S2
MW: 3431.85
EINECS: 256-342-8
Product Categories: Amino Acid Derivatives;Peptide;Calcitonin and CGRP receptor
Mol File: 47931-85-1.mol

 

Ms jessie/sales person

Career Hennan Chemical Co
Tel:+8617093661270

Wechat:17093661270

jessie@coreychem.com
www.coreychem.com

Company Profile Introduction

Henan CoreyChem Co., Ltd, based on the original Zhengzhou Cote Chemical Research Institute, be brave in absorbing highly educated talents & overseas returnees; actively responded to Zhengzhou City High-tech Zone Government’s Special Care Policy, reorganized and founded in National University of Science and Technology Park, which is a high-tech, stock enterprise of high-end chemical Custom synthesis;The park was created by the People's Government of Henan Province, and proved by Ministry of Education and the National Science & Technology, taking the construction mode of "many college a park, and common development", mainly depends on Zhengzhou University and Henan University’s scientific research and talent advantage to set up Universities, scientific research institute and enterprise scientific research achievements transformation platform, to make high-tech enterprises incubate,  is the new high-tech talent gathering base, high and new technology industry enterprise radiation base, colleges and universities technological innovation base.
 
Henan Coreychem Co., Ltd, facing global High-tech pharmaceutical raw materials, high complex new type intermediates, fine chemicals custom synthesis, scale-up production and Rare chemicals trade. Corey have well-equipped machine, strong technical force and considerate marketing team service. We also have rich experience advantage in basic research, small scale process development, scale-up, industrial technology development & production and cost control.
 

Recommended supplier

  • Since:2014-12-17
  • Address: No.967,15th Floor,Unit 7, Building 1, No.70 of DianChang Road, High-tech Development Zone, Zhengzho
INQUIRY