Contact us: +91 9550333722 040 - 40102781
Structured search
India
Choose your country
Different countries will display different contents
Try our best to find the right business for you.
My chemicalbook

Welcome back!

HomecompanySermorelin
Sermorelin
Sermorelin
Sermorelin
Sermorelin
Sermorelin
Sermorelin

Sermorelin

Price USD1.00
Packge 1KG
  • Min. Order:1KG
  • Supply Ability:20 tons
  • Time:2022-06-02

Product Details

  • Product NameSermorelin
  • CAS No.86168-78-7
  • EINECS No.1312995-182-4
  • MFC149H246N44O42S
  • MW3357.93
  • AppearanceSolidWhite to Off-White
  • storage temp. −20°C
  • density 1.45±0.1 g/cm3(Predicted)
  • Melting point >189°C (dec.)
Overview
  • Product Name: Sermorelin

  • CAS No.: 86168-78-7

  • Min. Order:1KG

  • Purity:99%

  • Supply Ability:100kg

  • Release date:2021/06/04

Product Advantage

JD607

Product Name:Sermorelin
Synonyms:SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS:86168-78-7
MF:C149H246N44O42S
MW:3357.88
EINECS:1312995-182-4
Product Categories:Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors
Mol File:86168-78-7.mol
Sermorelin Structure

Sermorelin Chemical Properties
alpha D20 -63.1° (c = 1 in 30% acetic acid)
storage temp. −20°C
CAS DataBase Reference86168-78-7(CAS DataBase Reference)

About Us:


Hebei Zhanyao Biotechnology Co. LTD is established in 2010, which is a fast growing intermediate company located in Shijiazhuang, Hebei Province. After ten years of development, Hebei Zhanyao has become a diversified company, not only involved in Pharmaceutical Intermediates, but also in the field of agricultural products. Also Have factory for plastic&rubbler granule, So far, Hebei Zhanyao has operations in 35 countries, and most of its big customers are from Europe and the United States. The quality of hebei Zhanyao products is always the best among Chinese suppliers, with some products of 99.9+ purity. This is an important reason for customers to choose


High quality with competitive price.

1. Standard bp/usp/ep/enterprise standard.

2. All purity>99%.

3. We are manufacturer and can provide high quality products with factory price.


Fast and safe delivery.

1. Parcel can be sent out in 24 hours after payment tracking number available.

2. Secure and discreet  shipment verious transportation methods for your choice.

3. Customs pass rate >99%.

4. We have our own agent/remailer/distributor who can help us ship our products very fast and safe, and we have stock in there for transferring.


We have clients throughout the world.

1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their desire.

2. Market feedback and goods feedback will be appreciated , meeting customers' requirement is our responsibility.

3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from the customers.

Company Profile Introduction

Hebei Zhanyao Biotechnology Co., Ltd. is a fast growing intermediate company located in Shijiazhuang city, Hebei Province. The main products of Zhanyao are pharmaceutical intermediates. In the future, it will become a diversified company, involving not only chemical industry but also agricultural products. Specializing in the production of carbomer hand sanitizer raw materials, disinfection tablets, Pregabalin, Monobenzone, soap granules, kojic acid, triclosan, chemical pharmaceutical intermediates, etc. At the same time owns plastic particle factory, such as HDPE, LDPE, LLDPE, EVA and so on. Currently, The company operates in 36 countries, with most of its market customers coming from Europe and the United States. The product quality of Hebei Zhanmedici has always been the best among domestic suppliers, with some products reaching 99.9+ purity, which is one of the reasons why more and more customers choose us. In order to maintain the highest level of product quality, our experienced engineers have established a professional quality control system. The company has a sound quality management system and advanced professional equipment, with a positive attitude to meet the changing needs of customers. The continuous improvement of quality management system and management structure has brought us more opportunities and competitive advantages in domestic and foreign markets. We take "high quality products, high quality service, competitive price, timely delivery" as our tenet, and look forward to greater cooperation with overseas customers on the basis of mutual benefit. Please feel free to contact us or visit our website for more information. Our company offers variety of products which can meet your multifarious demands. We adhere to the management principles of "quality first, customer first and credit-based" since the establishment of the company and always do our best to satisfy potential needs of our customers. Our company is sincerely willing to cooperate wit
  • Since:2015-10-08
  • Address: Room 1103-1,Haiyue Building,YuHuaXi Road, Qiaoxi District , Shijiazhuang, Hebei province
INQUIRY